Recombinant Human MYOG Protein, GST-tagged

• Cat.No.: MYOG-5853H
• Product Overview: Human MYOG full-length ORF ( AAH53899, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.38 kDa
• AA Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYOG myogenin (myogenic factor 4) [ Homo sapiens ]
• Official Symbol: MYOG
• Synonyms: MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; myf-4; myogenic factor 4; Myogenic factor-4; class C basic helix-loop-helix protein 3; MYOGENIN
• Gene ID: 4656
• mRNA Refseq: NM_002479
• Protein Refseq: NP_002470
• MIM: 159980
• UniProt ID: P15173