Recombinant Human MYOD1

• Cat.No.: MYOD1-28655TH
• Product Overview: Recombinant fragment corresponding to amino acids 211-320 of Human MyoD1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 110 amino acids
• Description: This gene encodes a nuclear protein that belongs to the basic helix-loop-helix family of transcription factors and the myogenic factors subfamily. It regulates muscle cell differentiation by inducing cell cycle arrest, a prerequisite for myogenic initiation. The protein is also involved in muscle regeneration. It activates its own transcription which may stabilize commitment to myogenesis.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLD CLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAP SEGESSGDPTQSPDAAPQCPAGANPNPIYQVL
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: MYOD1 myogenic differentiation 1 [ Homo sapiens ]
• Official Symbol: MYOD1
• Synonyms: MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM
• Gene ID: 4654
• mRNA Refseq: NM_002478
• Protein Refseq: NP_002469
• MIM: 159970
• Uniprot ID: P15172
• Chromosome Location: 11p15
• Pathway: C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem
• Function: DNA binding; E-box binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity