Recombinant Human MYO1E Protein, GST-tagged

• Cat.No.: MYO1E-5836H
• Product Overview: Human MYO1E partial ORF ( NP_004989.2, 918 a.a. - 1014 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the nonmuscle class I myosins which are a subgroup of the unconventional myosin protein family. The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. Among the class I myosins, this protein is distinguished by a long tail domain that is involved in crosslinking actin filaments. This protein localizes to the cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations in this gene are the cause of focal segmental glomerulosclerosis-6. This gene has been referred to as myosin IC in the literature but is distinct from the myosin IC gene located on chromosome 17. [provided by RefSeq, Jan 2012]
• Molecular Mass: 36.41 kDa
• AA Sequence: VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO1E myosin IE [ Homo sapiens (human) ]
• Official Symbol: MYO1E
• Synonyms: MYO1E myosin IE; unconventional myosin-Ie; MYO1E variant protein; myosin-IC; unconventional myosin 1E; FSGS6; MYO1C; HuncM-IC
• Gene ID: 4643
• mRNA Refseq: NM_004998
• Protein Refseq: NP_004989
• MIM: 601479
• UniProt ID: Q12965