Recombinant Human MYLPF

Cat.No. : MYLPF-30272TH
Product Overview : Recombinant full length Human MYLPF with a proprietary tag, MWt 44.7kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 169 amino acids
Description : Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
Molecular Weight : 44.700kDa inclusive of tags
Tissue specificity : Expressed in fetal and adult skeletal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
Official Symbol MYLPF
Synonyms MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory;
Gene ID 29895
mRNA Refseq NM_013292
Protein Refseq NP_037424
Uniprot ID Q96A32
Chromosome Location 16p11.2
Pathway ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem;
Function calcium ion binding; structural constituent of muscle;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYLPF Products

Required fields are marked with *

My Review for All MYLPF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon