Recombinant Human MYLPF

• Cat.No.: MYLPF-30272TH
• Product Overview: Recombinant full length Human MYLPF with a proprietary tag, MWt 44.7kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 169 amino acids
• Description: Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
• Molecular Weight: 44.700kDa inclusive of tags
• Tissue specificity: Expressed in fetal and adult skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
• Official Symbol: MYLPF
• Synonyms: MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory
• Gene ID: 29895
• mRNA Refseq: NM_013292
• Protein Refseq: NP_037424
• Uniprot ID: Q96A32
• Chromosome Location: 16p11.2
• Pathway: ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem
• Function: calcium ion binding; structural constituent of muscle