Recombinant Human MYL2 Protein, GST-tagged

• Cat.No.: MYL2-5808H
• Product Overview: Human MYL2 full-length ORF ( AAH15821.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq
• Molecular Mass: 44.00 kDa
• AA Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ]
• Official Symbol: MYL2
• Synonyms: MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10; MLC-2; MLC-2v; RLC of myosin; myosin light chain 2; regulatory light chain of myosin; slow cardiac myosin regulatory light chain 2; MLC2; DKFZp779C0562
• Gene ID: 4633
• mRNA Refseq: NM_000432
• Protein Refseq: NP_000423
• MIM: 160781
• UniProt ID: P10916