Recombinant Human MYBL1

• Cat.No.: MYBL1-29831TH
• Product Overview: Recombinant fragment of Human v-Myb with N terminal proprietary tag; Predicted MW 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Expressed in a variety of lymphoid and solid tumor lines cultured in vitro.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPL LEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVK LEKNLQSNCEWETVVYGKTEDQLIMTEQAR
• Sequence Similarities: Contains 3 HTH myb-type DNA-binding domains.

Gene Information

• Gene Name: MYBL1 v-myb myeloblastosis viral oncogene homolog (avian)-like 1 [ Homo sapiens ]
• Official Symbol: MYBL1
• Synonyms: MYBL1; v-myb myeloblastosis viral oncogene homolog (avian)-like 1; v myb avian myeloblastosis viral oncogene homolog like 1; myb-related protein A; A myb; AMYB
• Gene ID: 4603
• mRNA Refseq: NM_001080416
• Protein Refseq: NP_001073885
• MIM: 159405
• Uniprot ID: P10243
• Chromosome Location: 8q22
• Pathway: HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; IL4-mediated signaling events, organism-specific biosystem
• Function: DNA binding