Recombinant Human MVB12B Protein, GST-tagged

• Cat.No.: MVB12B-3694H
• Product Overview: Human FAM125B full-length ORF ( NP_001011703.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.9 kDa
• AA Sequence: MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MVB12B multivesicular body subunit 12B [ Homo sapiens (human) ]
• Official Symbol: MVB12B
• Synonyms: FAM125B; family with sequence similarity 125, member B; C9orf28, chromosome 9 open reading frame 28; multivesicular body subunit 12B; FLJ00001; ESCRT-I complex subunit MVB12B; MVB12B; C9orf28; MVB12B; multivesicular body subunit 12B
• Gene ID: 89853
• mRNA Refseq: NM_001011703
• Protein Refseq: NP_001011703
• UniProt ID: Q9H7P6