Recombinant Human MUSTN1 Protein, GST-tagged

• Cat.No.: MUSTN1-5761H
• Product Overview: Human MUSTN1 full-length ORF ( ADR83456.1, 1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MUSTN1 (Musculoskeletal, Embryonic Nuclear Protein 1) is a Protein Coding gene. An important paralog of this gene is ENSG00000243696.
• Molecular Mass: 9.1 kDa
• AA Sequence: MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MUSTN1 musculoskeletal, embryonic nuclear protein 1 [ Homo sapiens (human) ]
• Official Symbol: MUSTN1
• Synonyms: MUSTN1; musculoskeletal, embryonic nuclear protein 1; MUSTANG; musculoskeletal embryonic nuclear protein 1; musculoskeletal temporally activated novel
• Gene ID: 389125
• mRNA Refseq: NM_205853
• Protein Refseq: NP_995325
• MIM: 617195
• UniProt ID: Q8IVN3