Recombinant Human MUC1, His-tagged

• Cat.No.: MUC1-27747TH
• Product Overview: Recombinant Human MUC1(1095 to 1140) fussed with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1095-1140 a.a.
• Description: Mucin 1, cell surface associated (MUC1) or polymorphic epithelial mucin (PEM) is a mucin encoded by the MUC1 gene in humans. MUC1 is a glycoprotein with extensive O-linked glycosylation of its extracellular domain. Mucins line the apical surface of epithelial cells in the lungs, stomach, intestines, eyes and several other organs. Mucins protect the body from infection by pathogen binding to oligosaccharides in the extracellular domain, preventing the pathogen from reaching the cell surface. Overexpression of MUC1 is often associated with colon, breast, ovarian, lung and pancreatic cancers. Joyce Taylor-Papadimitriou identified and characterised the antigen during her work with breast and ovarian tumors.
• Form: Lyophilised
• Molecular Mass: 14 kDa including tags(His tag is 4kDa, Fusion protein size is 10 kDa)
• AA Sequence: RPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS
• Applications: Western blot; ELISA; SDS-PAGE
• Stability: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.Preservative: NoneConstituents: PBS
• Storage: Store at -20°C
• Reconstitution: Redissolve the powder with 1ml sterile water.

Gene Information

• Gene Name: MUC1 mucin 1, cell surface associated [ Homo sapiens ]
• Official Symbol: MUC1
• Synonyms: EMA; MCD; PEM; PUM; KL-6; MAM6; MCKD; PEMT; CD227; H23AG; MCKD1; MUC-1; ADMCKD; ADMCKD1; CA 15-3; MUC-1/X; MUC1/ZD; MUC-1/SEC; mucin-1; DF3 antigen; H23 antigen; Medullary cystic kidney disease, autosomal dominant; breast carcinoma-associated antigen DF3; cancer antigen 15-3; carcinoma-associated mucin; episialin; krebs von den Lungen-6; mucin 1, transmembrane; peanut-reactive urinary mucin; polymorphic epithelial mucin; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen
• Gene ID: 4582
• mRNA Refseq: NM_001018016
• Protein Refseq: NP_001018016
• MIM: 158340
• UniProt ID: P15941
• Chromosome Location: 1q21
• Pathway: IL-7 Signaling Pathway, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; O-linked glycosylation, organism-specific biosystem
• Function: p53 binding; protein binding; transcription cofactor activity