Recombinant Human MTOR Protein, GST tagged

• Cat.No.: MTOR-22H
• Product Overview: Recombinant Human MTOR Protein with GST tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mTORC1, which controls protein synthesis, cell growth and proliferation, and mTORC2, which is a regulator of the actin cytoskeleton, and promotes cell survival and cell cycle progression. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. Inhibitors of mTOR are used in organ transplants as immunosuppressants, and are being evaluated for their therapeutic potential in SARS-CoV-2 infections. Mutations in this gene are associated with Smith-Kingsmore syndrome and somatic focal cortical dysplasia type II. The ANGPTL7 gene is located in an intron of this gene.
• Source: E. coli
• Species: Human
• Molecular Mass: 38.4 kDa
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQ
• Purity: > 80% by SDS-PAGE
• Storage: Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 2.5 mg/mL
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens (human) ]
• Official Symbol: MTOR
• Synonyms: MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1, FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506 binding protein 12 rapamycin associated protein 2; FKBP rapamycin associated protein; FKBP12 rapamycin complex associated protein 1; FLJ44809; mammalian target of rapamycin; RAFT1; rapamycin and FKBP12 target 1; rapamycin associated protein FRAP2; rapamycin target protein; RAPT1; rapamycin target protein 1; FKBP-rapamycin associated protein; FKBP12-rapamycin complex-associated protein 1; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FRAP; FRAP1; FRAP2
• Gene ID: 2475
• mRNA Refseq: NM_004958
• Protein Refseq: NP_004949
• MIM: 601231
• UniProt ID: P42345