Recombinant Human MTMR12 protein, His-tagged
Cat.No. : | MTMR12-381H |
Product Overview : | Recombinant Human MTMR12 protein(NP_001035536)(1-350 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDEKKKTLFGQLKKYPEKLIIHCKDLRVFQFCLRYTKEEEVKRIVSGIIHHTQAPKLLKRLFLFSYATAAQNNTVTDPKNHTVMFDTLKDWCWELERTKGNMKYKAVSVNEGYKVCERLPAYFVVPTPLPEENVQRFQGHGIPIWCWSCHNGSALLKMSALPKEQDDGILQIQKSFLDGIYKTIHRPPYEIVKTEDLSSNFLSLQEIQTAYSKFKQLFLIDNSTEFWDTD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MTMR12 myotubularin related protein 12 [ Homo sapiens ] |
Official Symbol | MTMR12 |
Synonyms | MTMR12; myotubularin related protein 12; phosphatidylinositol 3 phosphate associated protein , PIP3AP; myotubularin-related protein 12; 3 PAP; 3PAP; FLJ20476; KIAA1682; 3-phosphatase adapter protein; 3-phosphatase adapter subunit; phosphatidylinositol-3-phosphate associated protein; phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit; phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit; 3-PAP; PIP3AP; |
Gene ID | 54545 |
mRNA Refseq | NM_001040446 |
Protein Refseq | NP_001035536 |
MIM | 606501 |
UniProt ID | Q9C0I1 |
◆ Recombinant Proteins | ||
MTMR12-6342Z | Recombinant Zebrafish MTMR12 | +Inquiry |
MTMR12-2184H | Recombinant Human MTMR12 Protein, MYC/DDK-tagged | +Inquiry |
Mtmr12-4215M | Recombinant Mouse Mtmr12 Protein, Myc/DDK-tagged | +Inquiry |
MTMR12-3813R | Recombinant Rat MTMR12 Protein | +Inquiry |
MTMR12-5787M | Recombinant Mouse MTMR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTMR12 Products
Required fields are marked with *
My Review for All MTMR12 Products
Required fields are marked with *
0
Inquiry Basket