Recombinant Human MTFP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MTFP1-5460H
• Product Overview: MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase signaling pathway that plays a role in cell viability and mitochondrial dynamics.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 18 kDa
• AA Sequence: MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MTFP1 mitochondrial fission process 1 [ Homo sapiens (human) ]
• Official Symbol: MTFP1
• Synonyms: MTFP1; mitochondrial fission process 1; MTP18; HSPC242; mitochondrial fission process protein 1; mitochondrial 18 kDa protein; mitochondrial fission protein MTP18; mitochondrial protein 18 kDa
• Gene ID: 51537
• mRNA Refseq: NM_016498
• Protein Refseq: NP_057582
• MIM: 610235
• UniProt ID: Q9UDX5