Recombinant Human MTFP1 Protein, GST-tagged

• Cat.No.: MTFP1-5729H
• Product Overview: Human MTP18 full-length ORF ( AAH01608, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44 kDa
• AA Sequence: MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTFP1 mitochondrial fission process 1 [ Homo sapiens (human) ]
• Official Symbol: MTFP1
• Synonyms: MTFP1; mitochondrial fission process 1; MTP18; HSPC242; mitochondrial fission process protein 1; mitochondrial 18 kDa protein; mitochondrial fission protein MTP18; mitochondrial protein 18 kDa
• Gene ID: 51537
• mRNA Refseq: NM_001003704
• Protein Refseq: NP_001003704
• MIM: 610235
• UniProt ID: Q9UDX5