Recombinant Human MT2A protein, GST-tagged

Cat.No. : MT2A-1070H
Product Overview : Recombinant Human MT2A protein(1-61 aa), fused with GST tag, was expressed in E.coli.
Availability March 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-61 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MT2A metallothionein 2A [ Homo sapiens ]
Official Symbol MT2A
Synonyms MT2A; metallothionein 2A; MT2; metallothionein-2; MT-2; MT-II; metallothionein-2A; metallothionein-II;
Gene ID 4502
mRNA Refseq NM_005953
Protein Refseq NP_005944
MIM 156360
UniProt ID P02795

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MT2A Products

Required fields are marked with *

My Review for All MT2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon