Recombinant Human MT1E Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MT1E-661H
• Product Overview: MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 6 kDa
• AA Sequence: MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MT1E metallothionein 1E [ Homo sapiens (human) ]
• Official Symbol: MT1E
• Synonyms: MT1E; metallothionein 1E; MT1; MTD; MT-1E; MT-IE; metallothionein-1E; metallothionein 1E (functional); metallothionein D; metallothionein-IE
• Gene ID: 4493
• mRNA Refseq: NM_175617
• Protein Refseq: NP_783316
• MIM: 156351
• UniProt ID: P04732