Recombinant Human MST1R Protein, GST-tagged
Cat.No. : | MST1R-5673H |
Product Overview : | Human MST1R partial ORF ( NP_002438, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase) [ Homo sapiens ] |
Official Symbol | MST1R |
Synonyms | MST1R; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); PTK8, PTK8 protein tyrosine kinase 8 , RON; macrophage-stimulating protein receptor; CD136; CDw136; p185-Ron; MSP receptor; RON variant E2E3; MST1R variant RON30; MST1R variant RON62; soluble RON variant 1; soluble RON variant 2; soluble RON variant 3; soluble RON variant 4; c-met-related tyrosine kinase; PTK8 protein tyrosine kinase 8; RON; PTK8; |
Gene ID | 4486 |
mRNA Refseq | NM_001244937 |
Protein Refseq | NP_001231866 |
MIM | 600168 |
UniProt ID | Q04912 |
◆ Recombinant Proteins | ||
MST1R-422H | Recombinant Human MST1R, GST-tagged, Active | +Inquiry |
MST1R-151H | Recombinant Human MST1R Protein, His-tagged | +Inquiry |
MST1R-30956TH | Recombinant Human MST1R | +Inquiry |
MST1R-2827H | Recombinant Human MST1R protein(871-950 aa), C-His-tagged | +Inquiry |
MST1R-5673H | Recombinant Human MST1R Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MST1R-1962HCL | Recombinant Human MST1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MST1R Products
Required fields are marked with *
My Review for All MST1R Products
Required fields are marked with *
0
Inquiry Basket