Recombinant Human MST1R protein(871-950 aa), C-His-tagged

• Cat.No.: MST1R-2827H
• Product Overview: Recombinant Human MST1R protein(Q04912)(871-950 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 871-950 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGP
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase) [ Homo sapiens ]
• Official Symbol: MST1R
• Synonyms: MST1R; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); PTK8, PTK8 protein tyrosine kinase 8 , RON; macrophage-stimulating protein receptor; CD136; CDw136; p185-Ron; MSP receptor; RON variant E2E3; MST1R variant RON30; MST1R variant RON62; soluble RON variant 1; soluble RON variant 2; soluble RON variant 3; soluble RON variant 4; c-met-related tyrosine kinase; PTK8 protein tyrosine kinase 8; RON; PTK8
• Gene ID: 4486
• mRNA Refseq: NM_001244937
• Protein Refseq: NP_001231866
• MIM: 600168
• UniProt ID: Q04912