Recombinant Human MST1 protein(371-470 aa), C-His-tagged

• Cat.No.: MST1-2704H
• Product Overview: Recombinant Human MST1 protein(P26927)(371-470 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 371-470 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 13.5 kDa
• AASequence: YHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: MST1 macrophage stimulating 1 (hepatocyte growth factor-like) [ Homo sapiens ]
• Official Symbol: MST1
• Synonyms: MST1; macrophage stimulating 1 (hepatocyte growth factor-like); D3F15S2, DNF15S2, HGFL; hepatocyte growth factor-like protein; hepatocyte growth factor like protein homolog; MSP; NF15S2; macrophage-stimulating protein; hepatocyte growth factor-like protein homolog; HGFL; D3F15S2; DNF15S2
• Gene ID: 4485
• mRNA Refseq: NM_020998
• Protein Refseq: NP_066278
• MIM: 142408
• UniProt ID: P26927