Recombinant Human MS4A1 protein(204-291 aa), GST-tagged

• Cat.No.: MS4A1-20H
• Product Overview: Recombinant Human MS4A1 protein(204-291 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 204-291 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AASequence: GIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ]
• Official Symbol: MS4A1
• Synonyms: MS4A1; membrane-spanning 4-domains, subfamily A, member 1; CD20; B-lymphocyte antigen CD20; B1; Bp35; MS4A2; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; S7; CVID5; LEU-16; MGC3969
• Gene ID: 931
• mRNA Refseq: NM_021950
• Protein Refseq: NP_068769
• MIM: 112210
• UniProt ID: P11836