Recombinant Human MRPS7, His-tagged
Cat.No. : | MRPS7-148H |
Product Overview : | Recombinant Human 28S Ribosomal Protein S7 Mitochondrial/MRPS7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser38-Trp242) of Human MRPS7 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 38-242 a.a. |
AA Sequence : | SPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGG NKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRF YQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEA NRALAHYRWWVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MRPS7 mitochondrial ribosomal protein S7 [ Homo sapiens ] |
Official Symbol | MRPS7 |
Synonyms | MRPS7; mitochondrial ribosomal protein S7; RP-S7; RPMS7; MRP-S7; |
Gene ID | 64967 |
◆ Recombinant Proteins | ||
MRPS7-2689R | Recombinant Rhesus Macaque MRPS7 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS7-2782C | Recombinant Chicken MRPS7 | +Inquiry |
MRPS7-6510HF | Recombinant Full Length Human MRPS7 Protein, GST-tagged | +Inquiry |
Mrps7-4175M | Recombinant Mouse Mrps7 Protein, Myc/DDK-tagged | +Inquiry |
MRPS7-5626H | Recombinant Human MRPS7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS7-4131HCL | Recombinant Human MRPS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS7 Products
Required fields are marked with *
My Review for All MRPS7 Products
Required fields are marked with *
0
Inquiry Basket