Recombinant Human MRPS7, His-tagged
Cat.No. : | MRPS7-148H |
Product Overview : | Recombinant Human 28S Ribosomal Protein S7 Mitochondrial/MRPS7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser38-Trp242) of Human MRPS7 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 38-242 a.a. |
AA Sequence : | SPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGG NKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRF YQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEA NRALAHYRWWVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MRPS7 mitochondrial ribosomal protein S7 [ Homo sapiens ] |
Official Symbol | MRPS7 |
Synonyms | MRPS7; mitochondrial ribosomal protein S7; RP-S7; RPMS7; MRP-S7; |
Gene ID | 64967 |
◆ Recombinant Proteins | ||
PROC-1743HFL | Recombinant Full Length Human PROC Protein, C-Flag-tagged | +Inquiry |
LRP10-515H | Recombinant Human LRP10 Protein, Fc-tagged | +Inquiry |
CD5-3098H | Recombinant Human CD5 Protein, MYC/DDK-tagged | +Inquiry |
Ggps1-3202M | Recombinant Mouse Ggps1 Protein, Myc/DDK-tagged | +Inquiry |
CD80-1376H | Acitve Recombinant Human CD80 protein(Met1-Asn242), His&Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAC8L1-3135HCL | Recombinant Human PLAC8L1 293 Cell Lysate | +Inquiry |
SERPINF2-2750MCL | Recombinant Mouse SERPINF2 cell lysate | +Inquiry |
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
CXorf41-7155HCL | Recombinant Human CXorf41 293 Cell Lysate | +Inquiry |
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRPS7 Products
Required fields are marked with *
My Review for All MRPS7 Products
Required fields are marked with *
0
Inquiry Basket