Recombinant Human MRPS7, His-tagged
| Cat.No. : | MRPS7-148H |
| Product Overview : | Recombinant Human 28S Ribosomal Protein S7 Mitochondrial/MRPS7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser38-Trp242) of Human MRPS7 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 38-242 a.a. |
| AA Sequence : | SPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGG NKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRF YQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEA NRALAHYRWWVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | MRPS7 mitochondrial ribosomal protein S7 [ Homo sapiens ] |
| Official Symbol | MRPS7 |
| Synonyms | MRPS7; mitochondrial ribosomal protein S7; RP-S7; RPMS7; MRP-S7; |
| Gene ID | 64967 |
| ◆ Recombinant Proteins | ||
| MRPS7-3402Z | Recombinant Zebrafish MRPS7 | +Inquiry |
| MRPS7-3782R | Recombinant Rat MRPS7 Protein | +Inquiry |
| MRPS7-3441R | Recombinant Rat MRPS7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPS7-148H | Recombinant Human MRPS7, His-tagged | +Inquiry |
| MRPS7-6510HF | Recombinant Full Length Human MRPS7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS7-4131HCL | Recombinant Human MRPS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS7 Products
Required fields are marked with *
My Review for All MRPS7 Products
Required fields are marked with *
0
Inquiry Basket
