Recombinant Human MRPL22, His-tagged

• Cat.No.: MRPL22-145H
• Product Overview: Recombinant Human 39S Ribosomal Protein L22 Mitochondrial/MRPL22 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile41-Leu206) of Human MRPL22 fused with a polyhistidine tag at the C-terminus.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: ISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDK KGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFV KLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTLVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 41-206 a.a.

Gene Information

• Gene Name: MRPL22 mitochondrial ribosomal protein L22 [ Homo sapiens ]
• Official Symbol: MRPL22
• Synonyms: MRPL22; mitochondrial ribosomal protein L22; 39S ribosomal protein L22, mitochondrial; HSPC158; MRP L25; RPML25; L25mt; 39S ribosomal protein L25, mitochondrial; L22mt; MRP-L22; MRP-L25; DKFZp781F1071
• Gene ID: 29093
• mRNA Refseq: NM_001014990
• Protein Refseq: NP_001014990
• MIM: 611835
• UniProt ID: Q9NWU5
• Chromosome Location: 5q33.2
• Function: structural constituent of ribosome