Recombinant Human MMP3 protein, His-SUMO-tagged

• Cat.No.: MMP3-3235H
• Product Overview: Recombinant Human MMP3 protein(P08254)(102-477aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.5 kDa
• Protein length: 102-477aa
• AA Sequence: TFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) [ Homo sapiens ]
• Official Symbol: MMP3
• Synonyms: MMP3; matrix metallopeptidase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3 (stromelysin 1, progelatinase) , STMY, STMY1; stromelysin-1; transin-1; proteoglycanase; matrix metalloproteinase-3; matrix metalloproteinase 3 (stromelysin 1, progelatinase); SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; MGC126102; MGC126103; MGC126104
• Gene ID: 4314
• mRNA Refseq: NM_002422
• Protein Refseq: NP_002413
• MIM: 185250
• UniProt ID: P08254