Recombinant Human MMP16 protein, His-tagged

Cat.No. : MMP16-712H
Product Overview : Recombinant Human MMP16 protein(NP_005932)(33-400 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 33-400 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : TVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MMP16 matrix metallopeptidase 16 (membrane-inserted) [ Homo sapiens ]
Official Symbol MMP16
Synonyms MMP16; matrix metallopeptidase 16 (membrane-inserted); C8orf57, chromosome 8 open reading frame 57 , matrix metalloproteinase 16 (membrane inserted); matrix metalloproteinase-16; DKFZp761D112; MT3 MMP; MMP-16; MT3MMP; MTMMP3; MT-MMP 3; Putative transmembrane protein C8orf57; membrane-type matrix metalloproteinase 3; membrane-type-3 matrix metalloproteinase; MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP;
Gene ID 4325
mRNA Refseq NM_005941
Protein Refseq NP_005932
MIM 602262
UniProt ID P51512

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMP16 Products

Required fields are marked with *

My Review for All MMP16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon