Recombinant Human MMP13 protein(361-430 aa), C-His-tagged

• Cat.No.: MMP13-2765H
• Product Overview: Recombinant Human MMP13 protein(P45452)(361-430 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 361-430 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK

Gene Information

• Gene Name: MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ]
• Official Symbol: MMP13
• Synonyms: MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1
• Gene ID: 4322
• mRNA Refseq: NM_002427
• Protein Refseq: NP_002418
• MIM: 600108
• UniProt ID: P45452