Recombinant Human MMP13 protein(361-430 aa), C-His-tagged
Cat.No. : | MMP13-2765H |
Product Overview : | Recombinant Human MMP13 protein(P45452)(361-430 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 361-430 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDK |
Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ] |
Official Symbol | MMP13 |
Synonyms | MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1; |
Gene ID | 4322 |
mRNA Refseq | NM_002427 |
Protein Refseq | NP_002418 |
MIM | 600108 |
UniProt ID | P45452 |
◆ Recombinant Proteins | ||
MMP13-1119C | Recombinant Cattle MMP13 Protein, His-tagged | +Inquiry |
MMP13-810H | Active Recombinant Human MMP13, His-tagged | +Inquiry |
MMP13-736R | Recombinant Rabbit MMP13 protein, His-tagged | +Inquiry |
MMP13-0832H | Recombinant Human MMP13 Protein (E103-N274), Tag Free | +Inquiry |
MMP13-2045D | Recombinant Dog MMP13 Protein (28-478 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *
0
Inquiry Basket