Recombinant Human MMP1 Protein, GST-tagged
Cat.No. : | MMP1-5413H |
Product Overview : | Human MMP1 full-length ORF ( NP_002412.1, 1 a.a. - 469 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants.[provided by RefSeq |
Molecular Mass : | 80.4 kDa |
AA Sequence : | MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ] |
Official Symbol | MMP1 |
Synonyms | MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN; |
Gene ID | 4312 |
mRNA Refseq | NM_001145938 |
Protein Refseq | NP_001139410 |
MIM | 120353 |
UniProt ID | P03956 |
◆ Recombinant Proteins | ||
MMP1-724C | Recombinant Cattle MMP1 protein, His & T7-tagged | +Inquiry |
MMP1-245H | Recombinant Human matrix metallopeptidase 1 Protein, Flag tagged | +Inquiry |
MMP1-1114H | Recombinant Human MMP1 Protein, His-tagged | +Inquiry |
MMP1-5412H | Active Recombinant Human MMP1 Protein | +Inquiry |
MMP1-4450H | Recombinant Human MMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP1-45H | Native Human MMP-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP1-2884HCL | Recombinant Human MMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP1 Products
Required fields are marked with *
My Review for All MMP1 Products
Required fields are marked with *
0
Inquiry Basket