Recombinant Human MMP1 protein(111-290 aa), N-MBP & C-His-tagged

• Cat.No.: MMP1-2535H
• Product Overview: Recombinant Human MMP1 protein(P03956)(111-290 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 111-290 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTI

Gene Information

• Gene Name: MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ]
• Official Symbol: MMP1
• Synonyms: MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN
• Gene ID: 4312
• mRNA Refseq: NM_001145938
• Protein Refseq: NP_001139410
• MIM: 120353
• UniProt ID: P03956