Recombinant Human MLST8 protein, GST-tagged
Cat.No. : | MLST8-301105H |
Product Overview : | Recombinant Human MLST8 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gly326 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MLST8 MTOR associated protein, LST8 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MLST8 |
Synonyms | MLST8; MTOR associated protein, LST8 homolog (S. cerevisiae); target of rapamycin complex subunit LST8; G protein beta subunit like; GbetaL; GBL; Lst8; Pop3; gable; protein GbetaL; TORC subunit LST8; mammalian lethal with SEC13 protein 8; LST8; POP3; WAT1; MGC111011; |
Gene ID | 64223 |
mRNA Refseq | NM_001199173 |
Protein Refseq | NP_001186102 |
MIM | 612190 |
UniProt ID | Q9BVC4 |
◆ Recombinant Proteins | ||
MLST8-2917H | Recombinant Human MTOR Associated Protein, LST8 Homolog (S. cerevisiae), T7-tagged | +Inquiry |
MLST8-1444H | Recombinant Human MLST8 protein, His & T7-tagged | +Inquiry |
MLST8-301105H | Recombinant Human MLST8 protein, GST-tagged | +Inquiry |
MLST8-5589M | Recombinant Mouse MLST8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLST8-5397H | Recombinant Human MLST8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLST8-4288HCL | Recombinant Human MLST8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLST8 Products
Required fields are marked with *
My Review for All MLST8 Products
Required fields are marked with *
0
Inquiry Basket