Recombinant Human MLH1, StrepII-tagged

• Cat.No.: MLH1-233H
• Product Overview: Purified human recombinant DNA mismatch repair MLH1 protein (amino acids 410-652, 243 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 27.4 kDa. (Accession NP_000240.1; UniProt P40692)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 410-652, 243 a.a.
• Description: This product is a fragment of MLH1, which is a component of the post-replicative DNA mismatch repair system (MMR). It is a human homolog of the E. coli DNA mismatch repair gene mutL. Native MLH1 heterodimerizes with MLH3 to form MutL gamma, which plays a role in meiosis.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: AIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVED DSRKEMTAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEEL FYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEG NLIGLPLLIDNYVPPLEG
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: MLH1 mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) [ Homo sapiens ]
• Official Symbol: MLH1
• Synonyms: MLH1; mutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli); COCA2, mutL (E. coli) homolog 1 (colon cancer, nonpolyposis type 2); DNA mismatch repair protein Mlh1; FCC2; HNPCC; HNPCC2; COCA2; hMLH1; MGC5172
• Gene ID: 4292
• mRNA Refseq: NM_000249
• Protein Refseq: NP_000240
• MIM: 120436
• UniProt ID: P40692
• Chromosome Location: 3p22.3
• Pathway: BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Endometrial cancer, organism-specific biosystem; Endometrial cancer, conserved biosystem; Fanconi anemia pathway, organism-specific biosystem
• Function: ATP binding; ATPase activity; contributes_to MutSalpha complex binding; guanine/thymine mispair binding; mismatched DNA binding; protein binding; contributes_to protein binding; contributes_to single-stranded DNA binding