Recombinant Human MKI67IP Protein, GST-tagged

• Cat.No.: MKI67IP-5361H
• Product Overview: Human MKI67IP full-length ORF ( NP_115766.2, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.[provided by RefSeq
• Molecular Mass: 60.7 kDa
• AA Sequence: MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MKI67IP MKI67 (FHA domain) interacting nucleolar phosphoprotein [ Homo sapiens ]
• Official Symbol: MKI67IP
• Synonyms: MKI67IP; MKI67 (FHA domain) interacting nucleolar phosphoprotein; MKI67 FHA domain-interacting nucleolar phosphoprotein; NIFK; Nopp34; nucleolar protein interacting with the FHA domain of pKi 67; hNIFK; nucleolar phosphoprotein Nopp34; nucleolar protein interacting with the FHA domain of pKi-67
• Gene ID: 84365
• mRNA Refseq: NM_032390
• Protein Refseq: NP_115766
• MIM: 611970
• UniProt ID: Q9BYG3