Recombinant Human MIOX Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MIOX-1888H |
Product Overview : | MIOX MS Standard C13 and N15-labeled recombinant protein (NP_060054) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Belongs to the myo-inositol oxygenase family. |
Molecular Mass : | 33 kDa |
AA Sequence : | MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MIOX myo-inositol oxygenase [ Homo sapiens (human) ] |
Official Symbol | MIOX |
Synonyms | MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6, ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217; |
Gene ID | 55586 |
mRNA Refseq | NM_017584 |
Protein Refseq | NP_060054 |
MIM | 606774 |
UniProt ID | Q9UGB7 |
◆ Recombinant Proteins | ||
MIOX-5564M | Recombinant Mouse MIOX Protein, His (Fc)-Avi-tagged | +Inquiry |
MIOX-889H | Recombinant Human MIOX Protein, MYC/DDK-tagged | +Inquiry |
MIOX-3346Z | Recombinant Zebrafish MIOX | +Inquiry |
MIOX-1477HFL | Recombinant Full Length Human MIOX Protein, C-Flag-tagged | +Inquiry |
MIOX-885H | Recombinant Human MIOX protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIOX-4311HCL | Recombinant Human MIOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIOX Products
Required fields are marked with *
My Review for All MIOX Products
Required fields are marked with *
0
Inquiry Basket