Recombinant Human MID1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MID1IP1-5505H
Product Overview : MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MID1IP1 (MID1 Interacting Protein 1) is a Protein Coding gene. Diseases associated with MID1IP1 include Gluten Allergy and Scoliosis. Among its related pathways are Import of palmitoyl-CoA into the mitochondrial matrix and Metabolism. Gene Ontology (GO) annotations related to this gene include protein C-terminus binding. An important paralog of this gene is THRSP.
Molecular Mass : 20.2 kDa
AA Sequence : MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MID1IP1 MID1 interacting protein 1 [ Homo sapiens (human) ]
Official Symbol MID1IP1
Synonyms MID1IP1; S14R; MIG12; THRSPL; G12-like; STRAIT11499; MID1 interacting protein 1; mid1-interacting protein 1; spot 14-R; spot 14-related protein; MID1 interacting G12-like protein; gastrulation specific G12 homolog; mid1-interacting G12-like protein; gastrulation-specific G12-like protein; MID1 interacting protein 1 (gastrulation specific G12-like)
Gene ID 58526
mRNA Refseq NM_021242
Protein Refseq NP_067065
MIM 300961
UniProt ID Q9NPA3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MID1IP1 Products

Required fields are marked with *

My Review for All MID1IP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon