Recombinant Human MGAT4A protein, His-tagged
Cat.No. : | MGAT4A-4391H |
Product Overview : | Recombinant Human MGAT4A protein(Q9UM21)(93-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 93-535aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.0 kDa |
AA Sequence : | LLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | MGAT4A mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A [ Homo sapiens ] |
Official Symbol | MGAT4A |
Synonyms | MGAT4A; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A; mannosyl (alpha 1,3 ) glycoprotein beta 1,4 N acetylglucosaminyltransferase, isoenzyme A; alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A; GnT 4a; GnT Iva; glcNAc-T IVa; N-acetylglucosaminyltransferase IVa; UDP-GlcNAc:a-1,3-D-mannoside b-1,4-acetylglucosaminyltransferase IV; alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa; UDP-N-acetylglucosamine:alpha1,3-d-mannoside beta1,4-N-acetylglucosaminyltransferase; mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isoenzyme A; UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa; GNT-IV; GnT-4a; GNT-IVA; |
Gene ID | 11320 |
mRNA Refseq | NM_001160154 |
Protein Refseq | NP_001153626 |
MIM | 604623 |
UniProt ID | Q9UM21 |
◆ Recombinant Proteins | ||
MGAT4A-859H | Recombinant Human MGAT4A protein, GST-tagged | +Inquiry |
MGAT4A-436C | Recombinant Cynomolgus Monkey MGAT4A Protein, His (Fc)-Avi-tagged | +Inquiry |
MGAT4A-3327R | Recombinant Rat MGAT4A Protein, His (Fc)-Avi-tagged | +Inquiry |
MGAT4A-2909H | Recombinant Human MGAT4A protein, His-tagged | +Inquiry |
MGAT4A-5935H | Recombinant Human MGAT4A protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGAT4A-4342HCL | Recombinant Human MGAT4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGAT4A Products
Required fields are marked with *
My Review for All MGAT4A Products
Required fields are marked with *
0
Inquiry Basket