Recombinant Human MFAP4 Protein, GST-tagged

• Cat.No.: MFAP4-4389H
• Product Overview: Human MFAP4 full-length ORF ( NP_002395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. [provided by RefSeq
• Molecular Mass: 55 kDa
• AA Sequence: MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MFAP4 microfibrillar-associated protein 4 [ Homo sapiens ]
• Official Symbol: MFAP4
• Synonyms: MFAP4; microfibrillar-associated protein 4; microfibril-associated glycoprotein 4; microfibril associated glycoprotein 4
• Gene ID: 4239
• mRNA Refseq: NM_001198695
• Protein Refseq: NP_001185624
• MIM: 600596
• UniProt ID: P55083