Recombinant Human METTL9 Protein, GST-tagged

• Cat.No.: METTL9-4396H
• Product Overview: Human METTL9 full-length ORF (BAC11356.1, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: METTL9 (Methyltransferase Like 9) is a Protein Coding gene. Diseases associated with METTL9 include Inflammatory Bowel Disease 1. GO annotations related to this gene include methyltransferase activity.
• Molecular Mass: 62.8 kDa
• AA Sequence: MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL9 methyltransferase like 9 [ Homo sapiens (human) ]
• Official Symbol: METTL9
• Synonyms: METTL9; methyltransferase like 9; DREV; PAP1; DREV1; CGI-81; methyltransferase-like protein 9; CTB-31N19.3; DORA reverse strand protein 1; p53 activated protein 1
• Gene ID: 51108
• mRNA Refseq: NM_001077180
• Protein Refseq: NP_001070648
• MIM: 609388
• UniProt ID: Q9H1A3