Recombinant Human METTL21A Protein, GST-tagged

• Cat.No.: METTL21A-4405H
• Product Overview: Human METTL21A full-length ORF ( NP_660323.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: METTL21A (Methyltransferase Like 21A) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Protein methylation. GO annotations related to this gene include methyltransferase activity and Hsp70 protein binding. An important paralog of this gene is EEF1AKMT3.
• Molecular Mass: 51 kDa
• AA Sequence: MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL21A methyltransferase like 21A [ Homo sapiens ]
• Official Symbol: METTL21A
• Synonyms: METTL21A; methyltransferase like 21A; FAM119A, family with sequence similarity 119, member A; methyltransferase-like protein 21A; HCA557b; Hepatocellular carcinoma associated antigen 557b; LOC151194; family with sequence similarity 119, member A; hepatocellular carcinoma-associated antigen 557b; FAM119A; MGC45373
• Gene ID: 151194
• mRNA Refseq: NM_001127395
• Protein Refseq: NP_001120867
• UniProt ID: Q8WXB1