Recombinant Human METTL14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: METTL14-6626H
• Product Overview: METTL14 MS Standard C13 and N15-labeled recombinant protein (NP_066012) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: METTL14 (Methyltransferase Like 14) is a Protein Coding gene. Diseases associated with METTL14 include Miyoshi Muscular Dystrophy 3 and Periosteal Chondrosarcoma. Among its related pathways are Chromatin Regulation / Acetylation and Gene Expression. Gene Ontology (GO) annotations related to this gene include RNA binding and mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity.
• Molecular Mass: 52.2 kDa
• AA Sequence: MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: METTL14 methyltransferase like 14 [ Homo sapiens (human) ]
• Official Symbol: METTL14
• Synonyms: METTL14; methyltransferase like 14; hMETTL14; N6-adenosine-methyltransferase non-catalytic subunit; N6-adenosine-methyltransferase subunit METTL14; methyltransferase-like protein 14; EC 2.1.1.62
• Gene ID: 57721
• mRNA Refseq: NM_020961
• Protein Refseq: NP_066012
• MIM: 616504
• UniProt ID: Q9HCE5