Recombinant Human METTL14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : METTL14-6626H
Product Overview : METTL14 MS Standard C13 and N15-labeled recombinant protein (NP_066012) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Myc&DDK
Description : METTL14 (Methyltransferase Like 14) is a Protein Coding gene. Diseases associated with METTL14 include Miyoshi Muscular Dystrophy 3 and Periosteal Chondrosarcoma. Among its related pathways are Chromatin Regulation / Acetylation and Gene Expression. Gene Ontology (GO) annotations related to this gene include RNA binding and mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity.
Molecular Mass : 52.2 kDa
AA Sequence : MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name METTL14 methyltransferase like 14 [ Homo sapiens (human) ]
Official Symbol METTL14
Synonyms METTL14; methyltransferase like 14; hMETTL14; N6-adenosine-methyltransferase non-catalytic subunit; N6-adenosine-methyltransferase subunit METTL14; methyltransferase-like protein 14; EC 2.1.1.62
Gene ID 57721
mRNA Refseq NM_020961
Protein Refseq NP_066012
MIM 616504
UniProt ID Q9HCE5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All METTL14 Products

Required fields are marked with *

My Review for All METTL14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon