Recombinant Human MEOX1 Protein, GST-tagged

• Cat.No.: MEOX1-4443H
• Product Overview: Human MEOX1 full-length ORF ( NP_004518.1, 1 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
• Molecular Mass: 54.4 kDa
• AA Sequence: MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEOX1 mesenchyme homeobox 1 [ Homo sapiens ]
• Official Symbol: MEOX1
• Synonyms: MEOX1; mesenchyme homeobox 1; mesenchyme homeo box 1; homeobox protein MOX-1; MOX1
• Gene ID: 4222
• mRNA Refseq: NM_001040002
• Protein Refseq: NP_001035091
• MIM: 600147
• UniProt ID: P50221