Recombinant Human MEMO1 Protein, GST-tagged

• Cat.No.: MEMO1-4446H
• Product Overview: Human MEMO1 full-length ORF ( NP_057039.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MEMO1 (Mediator Of Cell Motility 1) is a Protein Coding gene. Among its related pathways are Signaling by ERBB2 and Signaling by GPCR.
• Molecular Mass: 60.1 kDa
• AA Sequence: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEMO1 mediator of cell motility 1 [ Homo sapiens ]
• Official Symbol: MEMO1
• Synonyms: MEMO; C2orf4; CGI-27; NS5ATP7
• Gene ID: 51072
• mRNA Refseq: NM_015955
• Protein Refseq: NP_057039
• MIM: 611786
• UniProt ID: Q9Y316