Recombinant Human MEIG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MEIG1-4909H
• Product Overview: MEIG1 MS Standard C13 and N15-labeled recombinant protein (NP_001074305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: MEIG1 (Meiosis/Spermiogenesis Associated 1) is a Protein Coding gene. Diseases associated with MEIG1 include Cardiomyopathy, Familial Hypertrophic, 7.
• Molecular Mass: 10.6 kDa
• AA Sequence: MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHKVKIYAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MEIG1 meiosis/spermiogenesis associated 1 [ Homo sapiens (human) ]
• Official Symbol: MEIG1
• Synonyms: MEIG1 meiosis/spermiogenesis associated 1; SPATA39; bA2K17.3; meiosis expressed gene 1 protein homolog; meiosis expressed gene 1 homolog; spermatogenesis associated 39
• Gene ID: 644890
• mRNA Refseq: NM_001080836
• Protein Refseq: NP_001074305
• MIM: 614174
• UniProt ID: Q5JSS6