Recombinant Human MEIG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MEIG1-4909H
Product Overview : MEIG1 MS Standard C13 and N15-labeled recombinant protein (NP_001074305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : MEIG1 (Meiosis/Spermiogenesis Associated 1) is a Protein Coding gene. Diseases associated with MEIG1 include Cardiomyopathy, Familial Hypertrophic, 7.
Molecular Mass : 10.6 kDa
AA Sequence : MASSDVKPKSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHKVKIYAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MEIG1 meiosis/spermiogenesis associated 1 [ Homo sapiens (human) ]
Official Symbol MEIG1
Synonyms MEIG1 meiosis/spermiogenesis associated 1; SPATA39; bA2K17.3; meiosis expressed gene 1 protein homolog; meiosis expressed gene 1 homolog; spermatogenesis associated 39
Gene ID 644890
mRNA Refseq NM_001080836
Protein Refseq NP_001074305
MIM 614174
UniProt ID Q5JSS6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MEIG1 Products

Required fields are marked with *

My Review for All MEIG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon