Recombinant Human MECR protein, GST-tagged

• Cat.No.: MECR-1825H
• Product Overview: Recombinant Human MECR protein(1-310 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1-310 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ]
• Official Symbol: MECR
• Synonyms: MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1; NRBF-1; hsNrbf-1; nuclear receptor-binding factor 1; mitochondrial 2-enoyl thioester reductase; homolog of yeast 2-enoyl thioester reductase; CGI-63
• Gene ID: 51102
• mRNA Refseq: NM_001024732
• Protein Refseq: NP_001019903
• MIM: 608205
• UniProt ID: Q9BV79