Recombinant Human MDM2 protein, T7/His-tagged

Cat.No. : MDM2-134H
Product Overview : Recombinant human MDM2 cDNA (491aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDT YTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSV SENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESL ALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDED DEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKL ENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDK EESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name MDM2 Mdm2, p53 E3 ubiquitin protein ligase homolog (mouse) [ Homo sapiens ]
Official Symbol MDM2
Synonyms MDM2; Mdm2, p53 E3 ubiquitin protein ligase homolog (mouse); Mdm2 p53 binding protein homolog (mouse) , Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) , mouse double minute 2, human homolog of; p53 binding protein; E3 ubiquitin-protein ligase Mdm2; HDM2; HDMX; MGC5370; oncoprotein Mdm2; MDM2 variant FB28; MDM2 variant FB30; double minute 2, human homolog of; p53-binding protein; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein; hdm2; ACTFS; MGC71221;
Gene ID 4193
mRNA Refseq NM_002392
Protein Refseq NP_002383
MIM 164785
UniProt ID Q00987
Chromosome Location 12q13-q14
Pathway AKT phosphorylates targets in the cytosol, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem;
Function enzyme binding; ligase activity; metal ion binding; p53 binding; protein binding; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MDM2 Products

Required fields are marked with *

My Review for All MDM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon