Recombinant Human MC4R Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MC4R-522H
• Product Overview: MC4R MS Standard C13 and N15-labeled recombinant protein (NP_005903) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 36.8 kDa
• AA Sequence: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSSRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MC4R melanocortin 4 receptor [ Homo sapiens (human) ]
• Official Symbol: MC4R
• Synonyms: MC4R; melanocortin 4 receptor; melanocortin receptor 4; MC4-R; MGC126851; MGC138197
• Gene ID: 4160
• mRNA Refseq: NM_005912
• Protein Refseq: NP_005903
• MIM: 155541
• UniProt ID: P32245