Recombinant Human MC4R

• Cat.No.: MC4R-29453TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag.

Specification

• Description: The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.
• Protein length: 43 amino acids
• Molecular Weight: 30.360kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Brain, placental, and gut tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
• Tag: Non

Gene Information

• Gene Name: MC4R melanocortin 4 receptor [ Homo sapiens ]
• Official Symbol: MC4R
• Synonyms: MC4R; melanocortin 4 receptor; melanocortin receptor 4
• Gene ID: 4160
• mRNA Refseq: NM_005912
• Protein Refseq: NP_005903
• MIM: 155541
• Uniprot ID: P32245
• Chromosome Location: 18q22
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem
• Function: G-protein coupled receptor activity; melanocortin receptor activity; melanocyte-stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding