Recombinant Human MBP protein, GST-tagged
Cat.No. : | MBP-30122H |
Product Overview : | Recombinant Human MBP (1-171 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Arg171 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MBP myelin basic protein [ Homo sapiens ] |
Official Symbol | MBP |
Synonyms | MBP; myelin basic protein; Golli-MBP; myelin basic protein; myelin A1 protein; myelin membrane encephalitogenic protein; MGC99675; |
Gene ID | 4155 |
mRNA Refseq | NM_001025081 |
Protein Refseq | NP_001020252 |
MIM | 159430 |
UniProt ID | P02686 |
◆ Recombinant Proteins | ||
MBP-2915HFL | Recombinant Full Length Human MBP protein, Flag-tagged | +Inquiry |
MBP-1099H | Recombinant Human MBP Protein, His&SUMO-tagged | +Inquiry |
MBP-2764H | Recombinant Human MBP protein, His & GST-tagged | +Inquiry |
MBP-2755P | Recombinant Pan-species (General) MBP Protein, His/MBP-tagged | +Inquiry |
MBP-1771R | Recombinant Rabbit MBP protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBP-4438HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4437HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBP Products
Required fields are marked with *
My Review for All MBP Products
Required fields are marked with *
0
Inquiry Basket