Recombinant Human MBOAT7 protein, His-tagged

• Cat.No.: MBOAT7-3901H
• Product Overview: Recombinant Human MBOAT7 protein(284-344 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 284-344 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MBOAT7 membrane bound O-acyltransferase domain containing 7 [ Homo sapiens ]
• Official Symbol: MBOAT7
• Synonyms: MBOAT7; membrane bound O-acyltransferase domain containing 7; LENG4, leukocyte receptor cluster (LRC) member 4; lysophospholipid acyltransferase 7; BB1; hMBOA 7; LPIAT; lysophosphatidylinositol acyltransferase; LPLAT 7; h-mboa-7; lyso-PI acyltransferase; leukocyte receptor cluster member 4; leukocyte receptor cluster (LRC) member 4; O-acyltransferase domain-containing protein 7; 1-acylglycerophosphatidylinositol O-acyltransferase; bladder and breast carcinoma-overexpressed gene 1 protein; membrane-bound O-acyltransferase domain-containing protein 7; malignant cell expression-enhanced gene/tumor progression-enhanced; LRC4; LENG4; MBOA7; OACT7; hMBOA-7; FLJ41296
• Gene ID: 79143
• mRNA Refseq: NM_001146056
• Protein Refseq: NP_001139528
• MIM: 606048
• UniProt ID: Q96N66