Recombinant Human MBNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MBNL3-5211H
• Product Overview: MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described.
• Molecular Mass: 36.2 kDa
• AA Sequence: MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQIPQLSIDELNSSMFVSQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MBNL3 muscleblind-like splicing regulator 3 [ Homo sapiens (human) ]
• Official Symbol: MBNL3
• Synonyms: MBNL3; muscleblind-like splicing regulator 3; muscleblind like 3 (Drosophila); muscleblind-like protein 3; CHCR; FLJ11316; MBLX39; MBXL; muscleblind-like 3; Cys3His CCG1-required protein; muscleblind-like X-linked protein; MBLX; FLJ97142
• Gene ID: 55796
• mRNA Refseq: NM_133486
• Protein Refseq: NP_597846
• MIM: 300413
• UniProt ID: Q9NUK0