Recombinant Human MBNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MBNL3-5211H
Product Overview : MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Myc&DDK
Description : This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described.
Molecular Mass : 36.2 kDa
AA Sequence : MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQIPQLSIDELNSSMFVSQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MBNL3 muscleblind-like splicing regulator 3 [ Homo sapiens (human) ]
Official Symbol MBNL3
Synonyms MBNL3; muscleblind-like splicing regulator 3; muscleblind like 3 (Drosophila); muscleblind-like protein 3; CHCR; FLJ11316; MBLX39; MBXL; muscleblind-like 3; Cys3His CCG1-required protein; muscleblind-like X-linked protein; MBLX; FLJ97142;
Gene ID 55796
mRNA Refseq NM_133486
Protein Refseq NP_597846
MIM 300413
UniProt ID Q9NUK0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MBNL3 Products

Required fields are marked with *

My Review for All MBNL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon