Recombinant Human MBL2 Protein, His-tagged

• Cat.No.: MBL2-377H
• Product Overview: Recombinant human MBL2 protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 248
• Description: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
• Form: Lyophilized
• Molecular Mass: 24.8 kDa
• AA Sequence: MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: MBL2 mannose-binding lectin (protein C) 2, soluble [ Homo sapiens (human) ]
• Official Symbol: MBL2
• Synonyms: MBL2; mannose-binding lectin (protein C) 2, soluble; mannose binding lectin (protein C) 2, soluble (opsonic defect) , MBL; mannose-binding protein C; COLEC1; collectin-1; mannan-binding lectin; mannose-binding lectin 2, soluble (opsonic defect); mannose-binding lectin (protein C) 2, soluble (opsonic defect); MBL; MBP; MBP1; MBL2D; MBP-C; HSMBPC; MGC116832; MGC116833
• Gene ID: 4153
• mRNA Refseq: NM_000242
• Protein Refseq: NP_000233
• MIM: 154545
• UniProt ID: P11226