Recombinant Human MARCHF8 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MARCHF8-1405H
• Product Overview: MARCH8 MS Standard C13 and N15-labeled recombinant protein (NP_659458) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins.
• Molecular Mass: 32.9 kDa
• AA Sequence: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MARCHF8 membrane associated ring-CH-type finger 8 [ Homo sapiens (human) ]
• Official Symbol: MARCHF8
• Synonyms: MARCHF8; membrane associated ring-CH-type finger 8; MIR; CMIR; c-MIR; MARCH8; RNF178; MARCH-VIII; E3 ubiquitin-protein ligase MARCHF8; E3 ubiquitin-protein ligase MARCH8; RING finger protein 178; RING-type E3 ubiquitin transferase MARCH8; RING-type E3 ubiquitin transferase MARCHF8; c-mir, cellular modulator of immune recognition; cellular modulator of immune recognition (c-MIR); membrane associated ring finger 8; membrane-associated RING finger protein 8; membrane-associated RING-CH protein VIII; membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase; EC 2.3.2.27
• Gene ID: 220972
• mRNA Refseq: NM_145021
• Protein Refseq: NP_659458
• MIM: 613335
• UniProt ID: Q5T0T0