Recombinant Human MAPRE2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MAPRE2-748H
• Product Overview: MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_001137299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants.
• Molecular Mass: 35.6 kDa
• AA Sequence: MKQNRDQKCPVSQRNSSFQQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MAPRE2 microtubule associated protein RP/EB family member 2 [ Homo sapiens (human) ]
• Official Symbol: MAPRE2
• Synonyms: MAPRE2; microtubule-associated protein, RP/EB family, member 2; microtubule-associated protein RP/EB family member 2; APC binding protein EB1; EB1; EB2; RP1; end-binding protein 2; APC-binding protein EB1; APC-binding protein EB2; T-cell activation protein, EB1 family
• Gene ID: 10982
• mRNA Refseq: NM_001143827
• Protein Refseq: NP_001137299
• MIM: 605789
• UniProt ID: Q15555