Recombinant Human MAPRE2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MAPRE2-748H |
Product Overview : | MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_001137299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MKQNRDQKCPVSQRNSSFQQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MAPRE2 microtubule associated protein RP/EB family member 2 [ Homo sapiens (human) ] |
Official Symbol | MAPRE2 |
Synonyms | MAPRE2; microtubule-associated protein, RP/EB family, member 2; microtubule-associated protein RP/EB family member 2; APC binding protein EB1; EB1; EB2; RP1; end-binding protein 2; APC-binding protein EB1; APC-binding protein EB2; T-cell activation protein, EB1 family; |
Gene ID | 10982 |
mRNA Refseq | NM_001143827 |
Protein Refseq | NP_001137299 |
MIM | 605789 |
UniProt ID | Q15555 |
◆ Recombinant Proteins | ||
MAPRE2-2498R | Recombinant Rhesus Macaque MAPRE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mapre2-3952M | Recombinant Mouse Mapre2 Protein, Myc/DDK-tagged | +Inquiry |
MAPRE2-3236R | Recombinant Rat MAPRE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPRE2-2698C | Recombinant Chicken MAPRE2 | +Inquiry |
MAPRE2-3580R | Recombinant Rat MAPRE2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPRE2-4480HCL | Recombinant Human MAPRE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPRE2 Products
Required fields are marked with *
My Review for All MAPRE2 Products
Required fields are marked with *
0
Inquiry Basket