Recombinant Human MAPK10 protein, His-tagged

• Cat.No.: MAPK10-2784H
• Product Overview: Recombinant Human MAPK10 protein(271-408 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 271-408 aa
• AA Sequence: QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAPK10 mitogen-activated protein kinase 10 [ Homo sapiens ]
• Official Symbol: MAPK10
• Synonyms: MAPK10; mitogen-activated protein kinase 10; PRKM10; JNK3; p54bSAPK; p493F12; MAPK 10; MAP kinase 10; MAP kinase p49 3F12; JNK3 alpha protein kinase; c-Jun N-terminal kinase 3; stress-activated protein kinase 1b; stress activated protein kinase beta; stress-activated protein kinase JNK3; JNK3A; SAPK1b; FLJ12099; FLJ33785; MGC50974
• Gene ID: 5602
• mRNA Refseq: NM_002753
• Protein Refseq: NP_002744
• MIM: 602897
• UniProt ID: P53779