Recombinant Human MAPK10 protein, His-tagged

Cat.No. : MAPK10-2784H
Product Overview : Recombinant Human MAPK10 protein(271-408 aa), fused to His tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length : 271-408 aa
AA Sequence : QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MAPK10 mitogen-activated protein kinase 10 [ Homo sapiens ]
Official Symbol MAPK10
Synonyms MAPK10; mitogen-activated protein kinase 10; PRKM10; JNK3; p54bSAPK; p493F12; MAPK 10; MAP kinase 10; MAP kinase p49 3F12; JNK3 alpha protein kinase; c-Jun N-terminal kinase 3; stress-activated protein kinase 1b; stress activated protein kinase beta; stress-activated protein kinase JNK3; JNK3A; SAPK1b; FLJ12099; FLJ33785; MGC50974;
Gene ID 5602
mRNA Refseq NM_002753
Protein Refseq NP_002744
MIM 602897
UniProt ID P53779

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAPK10 Products

Required fields are marked with *

My Review for All MAPK10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon